CDS

Accession Number TCMCG026C23081
gbkey CDS
Protein Id XP_012074303.1
Location complement(join(301732..301782,302608..302669,303758..303883,304107..304162,304321..304412,304492..304581))
Gene LOC105635803
GeneID 105635803
Organism Jatropha curcas

Protein

Length 158aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA673911
db_source XM_012218913.2
Definition transcription elongation factor SPT4 homolog 2 isoform X1 [Jatropha curcas]

EGGNOG-MAPPER Annotation

COG_category K
Description May regulate transcription elongation by RNA polymerase II. May enhance transcriptional pausing at sites proximal to the promoter, which may in turn facilitate the assembly of an elongation competent RNA polymerase II complex
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko03019        [VIEW IN KEGG]
ko03021        [VIEW IN KEGG]
KEGG_ko ko:K15171        [VIEW IN KEGG]
EC -
KEGG_Pathway -
GOs GO:0000993        [VIEW IN EMBL-EBI]
GO:0001098        [VIEW IN EMBL-EBI]
GO:0001099        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003676        [VIEW IN EMBL-EBI]
GO:0003700        [VIEW IN EMBL-EBI]
GO:0003723        [VIEW IN EMBL-EBI]
GO:0003727        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005515        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005654        [VIEW IN EMBL-EBI]
GO:0006139        [VIEW IN EMBL-EBI]
GO:0006325        [VIEW IN EMBL-EBI]
GO:0006355        [VIEW IN EMBL-EBI]
GO:0006357        [VIEW IN EMBL-EBI]
GO:0006396        [VIEW IN EMBL-EBI]
GO:0006397        [VIEW IN EMBL-EBI]
GO:0006725        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0006996        [VIEW IN EMBL-EBI]
GO:0008023        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009889        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010467        [VIEW IN EMBL-EBI]
GO:0010468        [VIEW IN EMBL-EBI]
GO:0010556        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0016070        [VIEW IN EMBL-EBI]
GO:0016071        [VIEW IN EMBL-EBI]
GO:0019219        [VIEW IN EMBL-EBI]
GO:0019222        [VIEW IN EMBL-EBI]
GO:0019899        [VIEW IN EMBL-EBI]
GO:0031323        [VIEW IN EMBL-EBI]
GO:0031326        [VIEW IN EMBL-EBI]
GO:0031974        [VIEW IN EMBL-EBI]
GO:0031981        [VIEW IN EMBL-EBI]
GO:0032044        [VIEW IN EMBL-EBI]
GO:0032784        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0034243        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043175        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043233        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044428        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044451        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0044877        [VIEW IN EMBL-EBI]
GO:0046483        [VIEW IN EMBL-EBI]
GO:0050789        [VIEW IN EMBL-EBI]
GO:0050794        [VIEW IN EMBL-EBI]
GO:0051171        [VIEW IN EMBL-EBI]
GO:0051252        [VIEW IN EMBL-EBI]
GO:0051276        [VIEW IN EMBL-EBI]
GO:0060255        [VIEW IN EMBL-EBI]
GO:0065007        [VIEW IN EMBL-EBI]
GO:0070013        [VIEW IN EMBL-EBI]
GO:0070063        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]
GO:0080090        [VIEW IN EMBL-EBI]
GO:0090304        [VIEW IN EMBL-EBI]
GO:0097159        [VIEW IN EMBL-EBI]
GO:0140110        [VIEW IN EMBL-EBI]
GO:1901360        [VIEW IN EMBL-EBI]
GO:1901363        [VIEW IN EMBL-EBI]
GO:1903506        [VIEW IN EMBL-EBI]
GO:2000112        [VIEW IN EMBL-EBI]
GO:2001141        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGGAAGCGCACCGGCACAAATTCCGACTAGCTTTGGTCATGAGCTGAGGGCTTGTCTTCGTTGCCGCCTCGTCAAAACCTATGATCAGTTTAGAGAGTCTGGATGCGAGAATTGCCCCTTCTTTAAGATGGATGAAGATCATGAGCGTGTGGTTGACTGCACTACTCCCAACTTTAATGGGATAATTTCTGTCATGGACCCAAGTAGAAGCTGGGCTGCTCGCTGGCTGAGAATTGGATTTAAGGATTCTTGTGGGAGAACAAGATTATTTTTTATACCGAGTCTGAATACCTACAAAGTTAGGAGATGCGGCGGAAGGATTTCAGATTGGTTTAATGTTCTATTTTGGATTTCTGATTCAGGAAGATTTGTTCCTGGTTGCTACACTCTTGCTGTCTCAGAGGCACTGCCAGAGGACTTGCAGAATTTATGTGAAGATGAACGTGTACAATACATTCCACCAAAACGTGTATGA
Protein:  
MGSAPAQIPTSFGHELRACLRCRLVKTYDQFRESGCENCPFFKMDEDHERVVDCTTPNFNGIISVMDPSRSWAARWLRIGFKDSCGRTRLFFIPSLNTYKVRRCGGRISDWFNVLFWISDSGRFVPGCYTLAVSEALPEDLQNLCEDERVQYIPPKRV